PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_371_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10143.7 Da    PI: 11.2657
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_371_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93.1e-293483251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +++fsstgklyeys+
  Neem_371_f_4 34 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLMVFSSTGKLYEYSN 83
                  8***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-402584IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.5812585IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-292588IPR002100Transcription factor, MADS-box
CDDcd002651.54E-382689No hitNo description
PROSITE patternPS0035002781IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-292747IPR002100Transcription factor, MADS-box
PfamPF003192.7E-263481IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-294762IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-296283IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGRSETPRKP VPSTRERVGG TLGDMGRGKI VIRRIDNSTS RQVTFSKRRN GLLKKARELS  60
ILCDAEVGLM VFSSTGKLYE YSNSRLDNLS P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-192689164Myocyte-specific enhancer factor 2A
3mu6_C1e-192689164Myocyte-specific enhancer factor 2A
3mu6_B1e-192689164Myocyte-specific enhancer factor 2A
3mu6_A1e-192689164Myocyte-specific enhancer factor 2A
1egw_D2e-192689164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-192689164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-192689164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-192689164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-192689164Myocyte-specific enhancer factor 2A
3p57_I2e-192689164Myocyte-specific enhancer factor 2A
3p57_D2e-192689164Myocyte-specific enhancer factor 2A
3p57_C2e-192689164Myocyte-specific enhancer factor 2A
3p57_B2e-192689164Myocyte-specific enhancer factor 2A
3p57_A2e-192689164Myocyte-specific enhancer factor 2A
3kov_J2e-192689164Myocyte-specific enhancer factor 2A
3kov_I2e-192689164Myocyte-specific enhancer factor 2A
3kov_B2e-192689164Myocyte-specific enhancer factor 2A
3kov_A2e-192689164Myocyte-specific enhancer factor 2A
1tqe_S2e-192587163Myocyte-specific enhancer factor 2B
1tqe_R2e-192587163Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042784.12e-34AGAMOUS-like 16
SwissprotQ6Z6W22e-33MAD57_ORYSJ; MADS-box transcription factor 57
SwissprotQ6EP492e-33MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A061E0X63e-34A0A061E0X6_THECC; AGAMOUS-like 16
TrEMBLF6HW462e-34F6HW46_VITVI; Putative uncharacterized protein
STRINGVIT_03s0097g00160.t017e-34(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.13e-33AGAMOUS-like 44